Iright
BRAND / VENDOR: Proteintech

Proteintech, 15048-1-AP, RTN1 (Isoform RTN1-C) Polyclonal antibody

CATALOG NUMBER: 15048-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RTN1 (Isoform RTN1-C) (15048-1-AP) by Proteintech is a Polyclonal antibody targeting RTN1 (Isoform RTN1-C) in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 15048-1-AP targets RTN1 (Isoform RTN1-C) in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, human brain tissue, rat brain tissue Positive IHC detected in: mouse cerebellum tissue, human brain tissue, human placenta tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Reticulon (RTN) proteins are a group of membrane-bound proteins that largely reside in endoplasmic reticulum (ER) (PMID: 18177508). Reticulon proteins share a common sequence feature, the reticulon homology domain (RHD). They are involved in shaping the tubular endoplasmic reticulum network, membrane trafficking, inhibition of axonal growth, and apoptosis (PMID: 24218324). Four mammalian reticulons (RTN1-4) exist. Human RTN1 (also known as NSP) gene is expressed predominantly in neuroendocrine tissues, and produces three isoforms termed RTN1-A (NSP-A), RTN1-B (NSP-B), and RTN1-C (NSP-C). This antibody is raised against the full-length protein of human RTN1-C. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7031 Product name: Recombinant human RTN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-208 aa of BC000314 Sequence: MQATADSTKMDCVWSNWKSQAIDLLYWRDIKQTGIVFGSFLLLLFSLTQFSVVSVVAYLALAALSATISFRIYKSVLQAVQKTDEGHPFKAYLELEITLSQEQIQKYTDCLQFYVNSTLKELRRLFLVQDLVDSLKFAVLMWLLTYVGALFNGLTLLLMAVVSMFTLPVVYVKHQAQIDQYLGLVRTHINAVVAKIQAKIPGAKRHAE Predict reactive species Full Name: reticulon 1 Calculated Molecular Weight: 84 kDa, 39 kDa, 24 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: BC000314 Gene Symbol: RTN1-C Gene ID (NCBI): 6252 RRID: AB_2185981 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16799 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924