Iright
BRAND / VENDOR: Proteintech

Proteintech, 15059-1-AP, HPRT Polyclonal antibody

CATALOG NUMBER: 15059-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HPRT (15059-1-AP) by Proteintech is a Polyclonal antibody targeting HPRT in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 15059-1-AP targets HPRT in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, A549 cells, mouse liver tissue, MCF-7 cells, HepG2 cells, Jurkat cells, Y79 cells, NIH/3T3 cells, mouse brain tissue, rat brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: mouse brain tissue, human liver cancer tissue, human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information HPRT, also named HPRT1 and HGPRT, plays a central role in the generation of purine nucleotides through the purine salvage pathway. Mutation of HPRT1 is associated with Lesch-Nyhan syndrome (LNS) which is an X-linked inherited neurogenetic disorder of purine metabolism. It has been reported that HPRT1 also plays an important role in HPRT-related gout. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7044 Product name: Recombinant human HPRT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-218 aa of BC000578 Sequence: MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA Predict reactive species Full Name: hypoxanthine phosphoribosyltransferase 1 Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 24-28 kDa GenBank Accession Number: BC000578 Gene Symbol: HPRT1 Gene ID (NCBI): 3251 RRID: AB_10638622 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P00492 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924