Iright
BRAND / VENDOR: Proteintech

Proteintech, 15066-1-AP, NDUFS3 Polyclonal antibody

CATALOG NUMBER: 15066-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NDUFS3 (15066-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFS3 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 15066-1-AP targets NDUFS3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293T cells, HEK-293 cells, HepG2 cells, NIH/3T3 cells, mouse heart tissue, rat brain tissue, mouse brain tissue, rat heart tissue Positive IP detected in: mouse heart tissue Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information NDUFS3(NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial) is also named as CI-30kD and belongs to the complex I 30 kDa subunit family. It catalyzes the oxidation of NADH, with the concomitant reduction of ubiquinone and ejection of protons out of the mitochondria(PMID:10967146). NDUFS3 can be used as a mitochondrial matrix control(PMID:17344420). The full length has a transit peptide with 36 amino acids. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7072 Product name: Recombinant human NDUFS3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-264 aa of BC000617 Sequence: MAAAAVARLWWRGILGASALTRGTGRPSVLLLPVRRESAGADTRPTVRPRNDVAHKQLSAFGEYVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK Predict reactive species Full Name: NADH dehydrogenase (ubiquinone) Fe-S protein 3, 30kDa (NADH-coenzyme Q reductase) Calculated Molecular Weight: 30 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC000617 Gene Symbol: NDUFS3 Gene ID (NCBI): 4722 RRID: AB_2151109 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75489 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924