Iright
BRAND / VENDOR: Proteintech

Proteintech, 15073-1-AP, METTL3 Polyclonal antibody

CATALOG NUMBER: 15073-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The METTL3 (15073-1-AP) by Proteintech is a Polyclonal antibody targeting METTL3 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat, monkey samples 15073-1-AP targets METTL3 in WB, IHC, IF/ICC, IF-P, IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, mouse, rat, monkey samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, HT-1080 cells, mouse testis tissue, HepG2 cells, Jurkat cells, Neuro-2a cells, A549 cells, NCCIT cells, COS-7 cells, rat testis tissue Positive IP detected in: HEK-293 cells Positive IHC detected in: human renal cell carcinoma tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse testis tissue Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:750-1:3000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information METTL3 is a key S-adenosyl-L-methionine-binding subunit, which is a component of a complex multicomponent enzyme that catalyzes the methylation of internal adenosine residues in eukaryotic mRNA, forming N6-methyladenosine. It contains 2 putative nuclear localization signals and 2 consensus methylation motifs. The calculated molecular weight of METTL3 is 64 kDa, but modified METTL3 is about 65-70 kDa. Specification Tested Reactivity: human, mouse, rat, monkey Cited Reactivity: human, mouse, rat, pig, monkey, chicken, zebrafish, hamster, goat, drosophila Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7110 Product name: Recombinant human METTL3 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 229-580 aa of BC001650 Sequence: LNQQSTKEQQSKKVSQEILELLNTTTAKEQSIVEKFRSRGRAQVQEFCDYGTKEECMKASDADRPCRKLHFRRIINKHTDESLGDCSFLNTCFHMDTCKYVHYEIDACMDSEAPGSKDHTPSQELALTQSVGGDSSADRLFPPQWICCDIRYLDVSILGKFAVVMADPPWDIHMELPYGTLTDDEMRRLNIPVLQDDGFLFLWVTGRAMELGRECLNLWGYERVDEIIWVKTNQLQRIIRTGRTGHWLNHGKEHCLVGVKGNPQGFNQGLDCDVIVAEVRSTSHKPDEIYGMIERLSPGTRKIELFGRPHNVQPNWITLGNQLDGIHLLDPDVVARFKQRYPDGIISKPKNL Predict reactive species Full Name: methyltransferase like 3 Calculated Molecular Weight: 64 kDa Observed Molecular Weight: 65-70 kDa GenBank Accession Number: BC001650 Gene Symbol: METTL3 Gene ID (NCBI): 56339 RRID: AB_2142033 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86U44 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924