Proteintech, 15076-1-AP, C7orf49 Polyclonal antibody

Size: 20ul / 150ul The C7orf49 (15076-1-AP) by Proteintech is a Polyclonal antibody targeting C7orf49 in IHC, ELISA applications with reactivity to human samples 15076-1-AP targets C7orf49 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human placenta tissue, human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information C7orf49, also named as MRI, may act as a regulator of proteasome. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7148 Product name: Recombinant human C7orf49 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-129 aa of BC000168 Sequence: MKAPKRMRMAAVPVAAARLPATRTVYCMNEAEIVDVALGILIESRKQEKACEQPALAGADNPEHSPPCSVSPHTSSGSSSEEEDSGKQALAPGLSPSQRPGGSSSACSRSPEEEEEEDVLKYVREIFFS Predict reactive species Full Name: chromosome 7 open reading frame 49 Calculated Molecular Weight: 17 kDa GenBank Accession Number: BC000168 Gene Symbol: C7orf49 Gene ID (NCBI): 78996 RRID: AB_2878107 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BWK5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.