Product Description
Size: 20ul / 150ul
The VPS8 (15079-1-AP) by Proteintech is a Polyclonal antibody targeting VPS8 in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples
15079-1-AP targets VPS8 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: human brain tissue, human testis tissue, mouse brain tissue, mouse liver tissue, PC-3 cells
Positive IP detected in: mouse brain tissue
Positive IF/ICC detected in: HepG2 cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:2400
Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
Background Information
VPS8, also named as KIAA0804, has some isoforms with MW 135-160 kDa and 70-90 kDa.
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag7151 Product name: Recombinant human VPS8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 56-147 aa of BC001001 Sequence: MSPSYHQSKGDPTAKKGTSEPVLDPQQIQAFDQLCRLYRGSSRLALLTELSQNRSSESYRPFSGSQSAPAFNSIFQNENFQLQLIPPPVTED Predict reactive species
Full Name: vacuolar protein sorting 8 homolog (S. cerevisiae)
Calculated Molecular Weight: 162 kDa
Observed Molecular Weight: 151 kDa
GenBank Accession Number: BC001001
Gene Symbol: VPS8
Gene ID (NCBI): 23355
RRID: AB_2215543
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q8N3P4
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924