Iright
BRAND / VENDOR: Proteintech

Proteintech, 15079-1-AP, VPS8 Polyclonal antibody

CATALOG NUMBER: 15079-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The VPS8 (15079-1-AP) by Proteintech is a Polyclonal antibody targeting VPS8 in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 15079-1-AP targets VPS8 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human brain tissue, human testis tissue, mouse brain tissue, mouse liver tissue, PC-3 cells Positive IP detected in: mouse brain tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2400 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information VPS8, also named as KIAA0804, has some isoforms with MW 135-160 kDa and 70-90 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7151 Product name: Recombinant human VPS8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 56-147 aa of BC001001 Sequence: MSPSYHQSKGDPTAKKGTSEPVLDPQQIQAFDQLCRLYRGSSRLALLTELSQNRSSESYRPFSGSQSAPAFNSIFQNENFQLQLIPPPVTED Predict reactive species Full Name: vacuolar protein sorting 8 homolog (S. cerevisiae) Calculated Molecular Weight: 162 kDa Observed Molecular Weight: 151 kDa GenBank Accession Number: BC001001 Gene Symbol: VPS8 Gene ID (NCBI): 23355 RRID: AB_2215543 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N3P4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924