Proteintech, 15087-1-AP, SEC61B Polyclonal antibody

Size: 20ul / 150ul The SEC61B (15087-1-AP) by Proteintech is a Polyclonal antibody targeting SEC61B in WB, IHC, IF/ICC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples 15087-1-AP targets SEC61B in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells, L02 cells, mouse liver tissue, rat liver tissue Positive IP detected in: HepG2 cells Positive IHC detected in: human liver tissue, human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse pancreas tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information The heteromeric SEC61 complex is composed of alpha, beta and gamma subunits. Oligomers of the SEC61 complex form a transmembrane channel where proteins are translocated across and integrated into the ER membrane (PMID: 10212142). SEC61B is the beta subunit of the SEC61 complex. It has been reported that SEC61B facilitates cotranslational protein transport and interacts with the signal peptidase during translocation (PMID: 9585408). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, monkey, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7169 Product name: Recombinant human SEC61B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-96 aa of BC001734 Sequence: MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS Predict reactive species Full Name: Sec61 beta subunit Calculated Molecular Weight: 10 kDa Observed Molecular Weight: 10-15 kDa GenBank Accession Number: BC001734 Gene Symbol: SEC61B Gene ID (NCBI): 10952 RRID: AB_2186411 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P60468 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.