Iright
BRAND / VENDOR: Proteintech

Proteintech, 15122-1-AP, SIRT5 Polyclonal antibody

CATALOG NUMBER: 15122-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SIRT5 (15122-1-AP) by Proteintech is a Polyclonal antibody targeting SIRT5 in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 15122-1-AP targets SIRT5 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HCT 116 cells, RAW 264.7 cells, mouse heart tissue, mouse liver tissue, rat heart tissue, rat liver tissue Positive IP detected in: mouse liver tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information SIRT5, a member fo sirtuin family that is a mitochondrial matrix NAD(+)-dependent deacetylase and mono-ADP-ribosyltransferases. Sirtuins play important role in various cellular processed, such as aging, gene silencing and metabolism. SIRT5 mainly locates in cytoplasm. It is an efficient protein lysine desuccinylase and demalonylase. During prolonged fasting, it can activate CPS1, the committed and regulated enzyme of the urea cycle, and contribute to the regulation of blood ammonia levels. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, bovine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7195 Product name: Recombinant human SIRT5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-310 aa of BC000126 Sequence: MRPLQIVPSRLISQLYCGLKPPASTRNQICLKMARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALACHENETVS Predict reactive species Full Name: sirtuin (silent mating type information regulation 2 homolog) 5 (S. cerevisiae) Calculated Molecular Weight: 34 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC000126 Gene Symbol: SIRT5 Gene ID (NCBI): 23408 RRID: AB_2188778 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NXA8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924