Iright
BRAND / VENDOR: Proteintech

Proteintech, 15140-1-AP, GLO1 Polyclonal antibody

CATALOG NUMBER: 15140-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GLO1 (15140-1-AP) by Proteintech is a Polyclonal antibody targeting GLO1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 15140-1-AP targets GLO1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Raji cells, HEK-293 cells, HeLa cells, rat liver tissue, HepG2 cells, mouse liver tissue Positive IP detected in: HepG2 cells Positive IHC detected in: human thyroid cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:1000 Background Information Glo1 is known to play a role in many diseases including diabetes mellitus, Alzheimer's disease, and cancer. The molecular mass of the dimer was 46 kDa determined by gel permeation chromatography. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7314 Product name: Recombinant human GLO1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-184 aa of BC001741 Sequence: MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLM Predict reactive species Full Name: glyoxalase I Calculated Molecular Weight: 21 kDa Observed Molecular Weight: 21-25 kDa GenBank Accession Number: BC001741 Gene Symbol: GLO1 Gene ID (NCBI): 2739 RRID: AB_2109890 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q04760 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924