Iright
BRAND / VENDOR: Proteintech

Proteintech, 15150-1-AP, KCNE1 Polyclonal antibody

CATALOG NUMBER: 15150-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KCNE1 (15150-1-AP) by Proteintech is a Polyclonal antibody targeting KCNE1 in WB, IF, ELISA applications with reactivity to human, mouse, rat samples 15150-1-AP targets KCNE1 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue Positive IF detected in: mouse heart tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunofluorescence (IF): IF : 1:20-1:200 Background Information Potassium voltage-gated channel subfamily E member 1 (KCNE1) is an ancillary protein that functions as a regulatory subunit of the voltage-gated potassium (Kv) channel complex composed of pore-forming and potassium-conducting alpha subunits and of regulatory beta subunits. KCNE1 beta subunit modulates the gating kinetics and enhances stability of the channel complex (PMID: 19219384; 20533308; 9230439). The KCNQ1 + KCNE1 potassium channel complex generates the slow delayed rectifier current (IKs), which is critical for cardiac repolarization (PMID: 41034624). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3495 Product name: Recombinant human KCNE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-106 aa of BC036452 Sequence: MILSNTTAVTPFLTKLWQETVQQGGNMSGLAHRSPRSGDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRS Predict reactive species Full Name: potassium voltage-gated channel, Isk-related family, member 1 Calculated Molecular Weight: 15 kDa Observed Molecular Weight: 15 kDa GenBank Accession Number: BC036452 Gene Symbol: KCNE1 Gene ID (NCBI): 3753 RRID: AB_2131977 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P15382 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924