Iright
BRAND / VENDOR: Proteintech

Proteintech, 15176-1-AP, Gamma Tubulin Polyclonal antibody

CATALOG NUMBER: 15176-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Gamma Tubulin (15176-1-AP) by Proteintech is a Polyclonal antibody targeting Gamma Tubulin in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat, canine samples 15176-1-AP targets Gamma Tubulin in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat, canine samples. Tested Applications Positive WB detected in: HeLa cells, Transfected HEK-293 cells Positive IP detected in: HeLa cells Positive IHC detected in: human prostate cancer tissue, human prostate hyperplasia tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Gamma tubulin is a member of tubulin superfamily and is a key component required for microtubule nucleation and stabilization. It is concentrated at the pericentriolar material of centrosomes in interphase cells, predominantly on spindle poles in mitotic cells, while found in midbodies during cytokinesis. Overexpression of gamma tubulin has been found in various cancers including breast cancer and gliomas. This antibody can well label the centrosome structure. Specification Tested Reactivity: human, mouse, rat, canine Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7070 Product name: Recombinant human tubulin-gamma protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 103-451 aa of BC000619 Sequence: NWASGFSQGEKIHEDIFDIIDREADGSDSLEGFVLCHSIAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPNQDEMSDVVVQPYNSLLTLKRLTQNADCVVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLPSAHRVSGLMMANHTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDEMDTSREIVQQLIDEYHAATRPDYISWGTQEQ Predict reactive species Full Name: tubulin, gamma 1 Calculated Molecular Weight: 51 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC000619 Gene Symbol: Gamma Tubulin Gene ID (NCBI): 7283 RRID: AB_2878113 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P23258 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924