Proteintech, 15205-1-AP, FADS3 Polyclonal antibody

Size: 20ul / 150ul The FADS3 (15205-1-AP) by Proteintech is a Polyclonal antibody targeting FADS3 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 15205-1-AP targets FADS3 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, EC109 cells, L02 cells, mouse kidney tissue, mouse skeletal muscle tissue, mouse liver tissue, rat skeletal muscle tissue Positive IP detected in: L02 cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information FADS3, also named as CYB5RP, belongs to fatty acid desaturase (FADS) gene family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. FADS family memebers are considered fusion products composed of an N-terminal cytochrome b5-like domain and a C-terminal multiple membrane-spanning desaturase protion, both of which are characterized by conserved histidine motifs. FADS3 can be detected as 40 kDa-51 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7355 Product name: Recombinant human FADS3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-130 aa of BC004901 Sequence: MGGVGEPGPREGPAQPGAPLPTFCWEQIRAHDQPGDKWLVIERRVYDISRWAQRHPGGSRLIGHHGAEDATDAFRAFHQDLNFVRKFLQPLLIGELAPEEPSQDGPLNAQLVEDFRALHQAAEDMKLFDA Predict reactive species Full Name: fatty acid desaturase 3 Calculated Molecular Weight: 51 kDa Observed Molecular Weight: 41-51 kDa GenBank Accession Number: BC004901 Gene Symbol: FADS3 Gene ID (NCBI): 3995 RRID: AB_10859776 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y5Q0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.