Iright
BRAND / VENDOR: Proteintech

Proteintech, 15209-1-AP, DDX19A Polyclonal antibody

CATALOG NUMBER: 15209-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DDX19A (15209-1-AP) by Proteintech is a Polyclonal antibody targeting DDX19A in WB, IHC, ELISA applications with reactivity to human samples 15209-1-AP targets DDX19A in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells, K-562 cells, HeLa cells Positive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information DDX19A, also known as DDX19L, belongs to the DEAD-box helicase family. DDX19A was identified as a novel cytosolic RNA sensor that could activate the NLRP3 inflammasome during virus infection. In addition, DDX19A was proven to be associated with NADPH oxidase 1 (NOX1)-mediated oxidative stress in tumor necrosis factor (TNF)-α-induced A549 cell (PMID: 33968728). DDX19A has 2 isoforms with the molecular mass of 44 and 54 kDa. DDX19A may represent biomarkers of metastasis and novel therapeutic targets in CSCC patients. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7362 Product name: Recombinant human DDX19A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 124-478 aa of BC005162 Sequence: MMLAEPPQNLIAQSQSGTGKTAAFVLAMLSRVEPSDRYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIEKIAN Predict reactive species Full Name: DEAD (Asp-Glu-Ala-As) box polypeptide 19A Calculated Molecular Weight: 54 kDa Observed Molecular Weight: 44 kDa and 54 kDa GenBank Accession Number: BC005162 Gene Symbol: DDX19A Gene ID (NCBI): 55308 RRID: AB_3085451 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NUU7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924