Product Description
Size: 20ul / 150ul
The FAIM2 (15211-1-AP) by Proteintech is a Polyclonal antibody targeting FAIM2 in WB, ELISA applications with reactivity to human, mouse, rat samples
15211-1-AP targets FAIM2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: mouse brain tissue, rat brain tissue
Recommended dilution
Western Blot (WB): WB : 1:500-1:3000
Background Information
Fas apoptotic inhibitory molecule 2 (FAIM2), also known as NMP35, TMBIM2 or Protein lifeguard (LFG), is a Fas antagonist highly expressed in the nervous system. FAIM2 is an intrinsic neuroprotective factor activated by stress in photoreceptors and delays FAS-mediated photoreceptor apoptosis (PMID: 28708137). FAIM2 is a potential pan-cancer biomarker for prognosis and immune infiltration (PMID: 36185230).
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag7366 Product name: Recombinant human FAIM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-104 aa of BC000051 Sequence: MTQGKLSVANKAPGTEGQQQVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVDPSSSSSYDNGFPTGDHELFTTFSWDDQKVRRVFVR Predict reactive species
Full Name: Fas apoptotic inhibitory molecule 2
Calculated Molecular Weight: 35 kDa
Observed Molecular Weight: 30 kDa
GenBank Accession Number: BC000051
Gene Symbol: FAIM2
Gene ID (NCBI): 23017
RRID: AB_3085452
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9BWQ8
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924