Iright
BRAND / VENDOR: Proteintech

Proteintech, 15211-1-AP, FAIM2 Polyclonal antibody

CATALOG NUMBER: 15211-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FAIM2 (15211-1-AP) by Proteintech is a Polyclonal antibody targeting FAIM2 in WB, ELISA applications with reactivity to human, mouse, rat samples 15211-1-AP targets FAIM2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information Fas apoptotic inhibitory molecule 2 (FAIM2), also known as NMP35, TMBIM2 or Protein lifeguard (LFG), is a Fas antagonist highly expressed in the nervous system. FAIM2 is an intrinsic neuroprotective factor activated by stress in photoreceptors and delays FAS-mediated photoreceptor apoptosis (PMID: 28708137). FAIM2 is a potential pan-cancer biomarker for prognosis and immune infiltration (PMID: 36185230). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7366 Product name: Recombinant human FAIM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-104 aa of BC000051 Sequence: MTQGKLSVANKAPGTEGQQQVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVDPSSSSSYDNGFPTGDHELFTTFSWDDQKVRRVFVR Predict reactive species Full Name: Fas apoptotic inhibitory molecule 2 Calculated Molecular Weight: 35 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC000051 Gene Symbol: FAIM2 Gene ID (NCBI): 23017 RRID: AB_3085452 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BWQ8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924