Proteintech, 15214-1-AP, GSTM3 Polyclonal antibody

Size: 20ul / 150ul The GSTM3 (15214-1-AP) by Proteintech is a Polyclonal antibody targeting GSTM3 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 15214-1-AP targets GSTM3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, human testis tissue, rat testis tissue Positive IP detected in: mouse testis tissue Positive IHC detected in: mouse testis tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information GSTM3 is a cytosolic enzyme involved in prostaglandin and leukotriene synthesis and in the metabolization of toxic compounds, such as chemotherapeutic drugs, insecticides, herbicides, carcinogens, and by-products of oxidative stress. GSTM3 is expressed in testis, brain, lung, and lymphocytes. GSTM3 have been reported to be dysregulated in cancers like prostate cancer and colon cancer. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, bovine, sheep Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7375 Product name: Recombinant human GSTM3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-225 aa of BC000088 Sequence: MSCESSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDLDFPNLPYLLDGKNKITQSNAILRYIARKHNMCGETEEEKIRVDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEELPGQLKQFSMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLDEFPNLKAFMCRFEALEKIAAYLQSDQFCKMPINNKMAQWGNKPVC Predict reactive species Full Name: glutathione S-transferase mu 3 (brain) Calculated Molecular Weight: 27 kDa Observed Molecular Weight: 27-29 kDa GenBank Accession Number: BC000088 Gene Symbol: GSTM3 Gene ID (NCBI): 2947 RRID: AB_2116070 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P21266 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.