Iright
BRAND / VENDOR: Proteintech

Proteintech, 15254-1-AP, GPR162 Polyclonal antibody

CATALOG NUMBER: 15254-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GPR162 (15254-1-AP) by Proteintech is a Polyclonal antibody targeting GPR162 in WB, ELISA applications with reactivity to human samples 15254-1-AP targets GPR162 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: SH-SY5Y cells, HeLa cells, human brain tissue, Y79 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7011 Product name: Recombinant human GPR162 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 328-588 aa of BC002353 Sequence: ERYRADVRTVWEQCVAIMSEEDGDDDGGCDDYAEGRVCKVRFDANGATGPGSRDPAQVKLLPGRHMLFPPLERVHYLQVPLSRRLSHDETNIFSTPREPGSFLHKWSSSDDIRVLPAQSRALGGPPEYLGQRHRLEDEEDEEEAEGGGLASLRQFLESGVLGSGGGPPRGPGFFREEITTFIDETPLPSPTASPGHSPRRPRPLGLSPRRLSLGSPESRAVGLPLGLSAGRRCSLTGGEESARAWGGSWGPGNPIFPQLTL Predict reactive species Full Name: G protein-coupled receptor 162 Calculated Molecular Weight: 64 kDa Observed Molecular Weight: 33 kDa, 64 kDa GenBank Accession Number: BC002353 Gene Symbol: GPR162 Gene ID (NCBI): 27239 RRID: AB_10665369 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16538 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924