Iright
BRAND / VENDOR: Proteintech

Proteintech, 15257-1-AP, Elastin Polyclonal antibody

CATALOG NUMBER: 15257-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Elastin (15257-1-AP) by Proteintech is a Polyclonal antibody targeting Elastin in WB, IHC, IP, ELISA applications with reactivity to human samples 15257-1-AP targets Elastin in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human artery tissue Positive IP detected in: human placenta tissue Positive IHC detected in: human lung tissue, human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information Elastic fibers are an abundant and integral part of many extracellular matrices, in which they provide the elastic properties to tissues such as arterial, lung, and skin. Elastic fibers are consisting of an elastin core surrounded by a mantle of fibrillin-rich microfibrils (PMID: 12082143). Elastin is an extremely durable, insoluble biopolymer formed through the lysine-mediated crosslinking of its soluble precursor tropoelastin, which is an approximately 60-70 kDa protein (PMID: 15837523). Deletions and mutations in the elastin gene (ELN) are associated with supravalvular aortic stenosis (SVAS) and autosomal dominant cutis laxa. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7179 Product name: Recombinant human ELN protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 307-658 aa of BC065566 Sequence: GLVPGGPGFGPGVVGVPGAGVPGVGVPGAGIPVVPGAGIPGAAVPGVVSPEAAAKAAAKAAKYGARPGVGVGGIPTYGVGAGGFPGFGVGVGGIPGVAGVPSVGGVPGVGGVPGVGISPEAQAAAAAKAAKYGLVPGVGVAPGVGVAPGVGVAPGVGLAPGVGVAPGVGVAPGVGVAPGIGPGGVAGAAAGLGAGIPGLGVGVGVPGLGVGAGVPGLGVGAGVPGFRAVPGALAAAKAAKYGAAVPGVLGGLGALGGVGIPGGVVGAGPAAAAAAAKAAAKAAQFGLVGAAGLGGLGVGGLGVPGVGGLGGIPPAAAAKAAKYGVAARPGFGLSPIFPGGACLGKACGRKRK Predict reactive species Full Name: elastin Calculated Molecular Weight: 68 kDa Observed Molecular Weight: 60-70 kDa GenBank Accession Number: BC065566 Gene Symbol: Elastin Gene ID (NCBI): 2006 RRID: AB_2878120 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P15502 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924