Iright
BRAND / VENDOR: Proteintech

Proteintech, 15274-1-AP, SPARC Polyclonal antibody

CATALOG NUMBER: 15274-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SPARC (15274-1-AP) by Proteintech is a Polyclonal antibody targeting SPARC in WB, IHC, ELISA applications with reactivity to human, mouse, rat, pig samples 15274-1-AP targets SPARC in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: A375 cells, human testis tissue, ROS1728 cells, human placenta tissue Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Background Information Secreted Protein Acidic And Cysteine Rich (SPARC), also known as osteonectin or basement-membrane protein 40 (BM-40), is a secreted protein essential in the calcification of bone.What is the molecular weight of SPARC?The calculated molecular mass of SPARC is 35 kDa. SPARC is a glycoprotein consisting of 303 amino acids in the cytoplasm and 286 amino acids after the signal sequence is cleaved in secretion.Where is SPARC expressed?Osteoblasts secrete SPARC during bone formation, with high levels found in immature bone compared to mature bone that is in homeostasis (PMID: 2440898). SPARC is also secreted in adult mineralized tissues that have high turnover, such as osteoid and dentin, by cells other than osteoblasts. This includes bone marrow progenitor cells and hypertrophic chondrocytes but also endothelial cells and fibroblasts.Though previously described as being exclusively expressed in mineralized tissue, it is now understood that SPARC is more widely expressed and is associated with high levels of collagen deposition, found in the extracellular matrix (ECM) of a number of tissues.What is the function of SPARC?SPARC contains both a collagen-binding domain and a hydroxyapatite (HA) binding region, so is thought to enhance mineralization by binding both collagen and HA crystals, causing the release of calcium ions (PMID: 26851678).SPARC can bind to a number of different ECM proteins, particularly collagen, and may even influence the assembly of these proteins (PMID: 19798598). It is known to regulate interactions between cells and the ECM, meaning it plays a role in many important processes such as cell migration and proliferation.What diseases are associated with SPARC?Overexpression of SPARC has been identified in a number of different types of cancers (PMID: 18849185), although its role may vary. For example, in neuroblastomas SPARC acts as a suppressor but in gliomas, it causes greater invasion of the tumor. Mutations in SPARC can also lead to Osteogenesis Imperfecta, also known as brittle bone disease (PMID: 26027498). Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human, mouse, rat, deer, sika deer Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7390 Product name: Recombinant human SPARC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-303 aa of BC004974 Sequence: MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI Predict reactive species Full Name: secreted protein, acidic, cysteine-rich (osteonectin) Calculated Molecular Weight: 35 kDa Observed Molecular Weight: 35-43 kDa GenBank Accession Number: BC004974 Gene Symbol: SPARC Gene ID (NCBI): 6678 RRID: AB_2194961 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P09486 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924