Iright
BRAND / VENDOR: Proteintech

Proteintech, 15320-1-AP, TNFAIP1 Polyclonal antibody

CATALOG NUMBER: 15320-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TNFAIP1 (15320-1-AP) by Proteintech is a Polyclonal antibody targeting TNFAIP1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 15320-1-AP targets TNFAIP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, L02 cells Positive IHC detected in: human placenta tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:300-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information TNFAIP1 was identified as a human gene activated transcriptionally by tumour necrosis factor alpha in endothelial cells. It is encoded by a 3.5-kilobase transcript and its expression is found to be developmentally regulated in a tissue-specific manner. The open reading frame predicts a 316-amino acid sequence rich in charged residues, particularly at the carboxyl terminus. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0220 Product name: Recombinant human TNFAIP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 71-239 aa of BC001949 Sequence: ILIDRCGKHFGTILNYLRDDTITLPQNRQEIKELMAEAKYYLIQGLVNMCQSALQDKKDSYQPVCNIPIITSLKEEERLIESSTKPVVKLLYNRSNNKYSYTSNSDDHLLKNIELFDKLSLRFNGRVLFIKDVIGDEICCWSFYGQGRKLAEVCCTSIVYATEKKQTKV Predict reactive species Full Name: tumor necrosis factor, alpha-induced protein 1 (endothelial) Calculated Molecular Weight: 36 kDa Observed Molecular Weight: 36 kDa GenBank Accession Number: BC001949 Gene Symbol: TNFAIP1 Gene ID (NCBI): 7126 RRID: AB_10644288 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13829 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924