Iright
BRAND / VENDOR: Proteintech

Proteintech, 15328-1-AP, SFRP4 Polyclonal antibody

CATALOG NUMBER: 15328-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SFRP4 (15328-1-AP) by Proteintech is a Polyclonal antibody targeting SFRP4 in WB, IP, IHC, ELISA applications with reactivity to human, rat samples 15328-1-AP targets SFRP4 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells Positive IP detected in: HeLa cells Positive IHC detected in: human breast cancer tissue, human skin cancer tissue, rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Secreted frizzled-related protein 4 (SFRP4) is a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. SFRP4 functions as a suppressor of tumor growth via inhibition of the Wnt signaling pathway.Downregulation or deletion of SFRP4 has been reported in several cancers and cell lines such as endometrial cancer, ovarian cancer, lung cancer,and others. This antibody got 41-51 kDa and 55 kDa bands in western blotting maybe due to differential posttranslational protein modification. Specification Tested Reactivity: human, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6909 Product name: Recombinant human SFRP4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-346 aa of BC058911 Sequence: MFLSILVALCLWLHLALGVRGAPCEAVRIPMCRHMPWNITRMPNHLHHSTQENAILAIEQYEELVDVNCSAVLRFFLCAMYAPICTLEFLHDPIKPCKSVCQRARDDCEPLMKMYNHSWPESLACDELPVYDRGVCISPEAIVTDLPEDVKWIDITPDMMVQERPLDVDCKRLSPDRCKCKKVKPTLATYLSKNYSYVIHAKIKAVQRSGCNEVTTVVDVKEIFKSSSPIPRTQVPLITNSSCQCPHILPHQDVLIMCYEWRSRMMLLENCLVEKWRDQLSKRSIQWEERLQEQRRTVQDKKKTAGRTSRSNPPKPKGKPPAPKPASPKKNIKTRSAQKRTNPKRV Predict reactive species Full Name: secreted frizzled-related protein 4 Calculated Molecular Weight: 40 kDa Observed Molecular Weight: 41-51 kDa, 55 kDa GenBank Accession Number: BC058911 Gene Symbol: SFRP4 Gene ID (NCBI): 6424 RRID: AB_2187099 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6FHJ7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924