Iright
BRAND / VENDOR: Proteintech

Proteintech, 15337-1-AP, CLPTM1 Polyclonal antibody

CATALOG NUMBER: 15337-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CLPTM1 (15337-1-AP) by Proteintech is a Polyclonal antibody targeting CLPTM1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 15337-1-AP targets CLPTM1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IP detected in: A549 cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Cleft lip and palate transmembrane protein 1 (CLPTM1), a multipass transmembrane protein, was identified due to the association of a chromosomal translocation with a cleft lip and palate (PMID: 9828125). CLPTM1 regulates epileptic seizures by modulating GABAAR-mediated inhibitory synaptic transmission (PMID: 36519412). Highly expressed CLPTM1L may contribute to a poor prognosis and increase invasion, proliferation and migration of oral squamous cell carcinoma (PMID: 34586883). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7538 Product name: Recombinant human CLPTM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC004865 Sequence: MAAAQEADGARSAVVAAGGGSSGQVTSNGSIGRDPPAETQPQNPPAQPAPNAWQVIKGVLFRIFIIWAISSWFRRGPAPQDQAGPGGAPRVASRNLFPKDTLMNLHVYISEHEHFTDFNATSALFWEQHDLVYGDWTSGENSDGCYEHFAELDIPQSVQQNGSIYIHVYFTKSGFHPDPRQKALYRRLATVHMSRMINKYKRRRFQKTKNLLTGETEADPEMIKRAEDYGPVEVISHWHPNITINIVDDHTPWVKGSVPPPLDQYVKFDAVSGDYYPIIYFNDYWNLQKDYYPINESLASLPLRVSFCPLSLWRWQLYAAQSTKSPWNFLGDELYEQSDEEQDSVKVALLE Predict reactive species Full Name: cleft lip and palate associated transmembrane protein 1 Calculated Molecular Weight: 62 kDa Observed Molecular Weight: 65-75 kDa GenBank Accession Number: BC004865 Gene Symbol: CLPTM1 Gene ID (NCBI): 1209 RRID: AB_3669204 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O96005 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924