Product Description
Size: 20ul / 150ul
The CRIP1 (15349-1-AP) by Proteintech is a Polyclonal antibody targeting CRIP1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples
15349-1-AP targets CRIP1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: HeLa cells, PC-3 cells
Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: HeLa cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
Background Information
CRIP1 also known as CRIP, CRP1, belongs to the LIM/double zinc finger protein family. CRIP1 has a unique double zinc finger motif, which is mainly expressed in the intestine, and may be involved in intestinal zinc transport (PMID: 31312368, 1946385). CRIP1 is overexpressed in immune cells of the epithelium and may play an important role in gut immunity(PMID: 27836662).
Specification
Tested Reactivity: human
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag7588 Product name: Recombinant human CRIP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-77 aa of BC002738 Sequence: MPKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHTFK Predict reactive species
Full Name: cysteine-rich protein 1 (intestinal)
Calculated Molecular Weight: 9 kDa
Observed Molecular Weight: 8-9 kDa
GenBank Accession Number: BC002738
Gene Symbol: CRIP1
Gene ID (NCBI): 1396
RRID: AB_2878128
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P50238
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924