Proteintech, 15371-1-AP, GLRB Polyclonal antibody

Size: 20ul / 150ul The GLRB (15371-1-AP) by Proteintech is a Polyclonal antibody targeting GLRB in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 15371-1-AP targets GLRB in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue, mouse spinal cord tissue Positive IHC detected in: mouse cerebellum tissue, rat cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Glycine is an inhibitory neurotransmitter in the central nervous system. The glycine receptor (GlyR) is a member of the nicotinic acetylcholine receptor of ligand-gated ion channels. This receptor has important roles in a variety of physiological processes, especially in mediating inhibitory neurotransmission in the spinal cord and brain stem. GlyR is a pentameric receptor comprised of alpha and beta subunits. Four alpha-subunits (GLRA1, GLRA2, GLRA3, GLRA4) and one beta-subunit (GLRB) of GlyR have been identified. (PMID: 11409700; 15383648) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4429 Product name: Recombinant human GLRB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 17-267 aa of BC032635 Sequence: VEEAYSKEKSSKKGKGKKKQYLCPSQQSAEDLARVPANSTSNILNRLLVSYDPRIRPNFKGIPVDVVVNIFINSFGSIQETTMDYRVNIFLRQKWNDPRLKLPSDFRGSDALTVDPTMYKCLWKPDLFFANEKSANFHDVTQENILLFIFRDGDVLVSMRLSITLSCPLDLTLFPMDTQRCKMQLESFGYTTDDLRFIWQSGDPVQLEKIALPQFDIKKEDIEYGNCTKYYKGTGYYTCVEVIFTLRRQVG Predict reactive species Full Name: glycine receptor, beta Calculated Molecular Weight: 56 kDa Observed Molecular Weight: 56 kDa GenBank Accession Number: BC032635 Gene Symbol: GLRB Gene ID (NCBI): 2743 RRID: AB_2878132 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P48167 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.