Proteintech, 15435-1-AP, CA11 Polyclonal antibody

Size: 20ul / 150ul The CA11 (15435-1-AP) by Proteintech is a Polyclonal antibody targeting CA11 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 15435-1-AP targets CA11 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human kidney tissue Positive IHC detected in: human brain tissue, human lung tissue, human ovary tissue, human placenta tissue, human spleen tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information CA11(Carbonic anhydrase-related protein 11) is also named CARP2, and CARP XI and belongs to the alpha-carbonic anhydrase family. CARP XI is observed in the cerebellum, cerebrum, liver, stomach, small intestine, colon, kidney, and testis by immunohistochemical, and in the cerebellum, the most prominent signal is located in the Purkinje cells(PMID:20356370). CARP XI contains a hydrophobic N-terminal region for a possible signal sequence and asparagine glycosylation site and it plays a general role in the human central nervous system(PMID: 10350627). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7712 Product name: Recombinant human CA11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 12-328 aa of BC002662 Sequence: ALVLWAALGAAAHIGPAPDPEDWWSYKDNLQGNFVPGPPFWGLVNAAWSLCAVGKRQSPVDVELKRVLYDPFLPPLRLSTGGEKLRGTLYNTGRHVSFLPAPRPVVNVSGGPLLYSHRLSELRLLFGARDGAGSEHQINHQGFSAEVQLIHFNQELYGNFSAASRGPNGLAILSLFVNVASTSNPFLSRLLNRDTITRISYKNDAYFLQDLSLELLFPESFGFITYQGSLSTPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQIFQSLSGNSRPLQPLAHRALRGNRDPRHPERRCRGPNYRLHVDGVPHGR Predict reactive species Full Name: carbonic anhydrase XI Calculated Molecular Weight: 36 kDa Observed Molecular Weight: 36, 45 kDa GenBank Accession Number: BC002662 Gene Symbol: CA11 Gene ID (NCBI): 770 RRID: AB_2065700 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75493 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.