Iright
BRAND / VENDOR: Proteintech

Proteintech, 15456-1-AP, NOL12 Polyclonal antibody

CATALOG NUMBER: 15456-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NOL12 (15456-1-AP) by Proteintech is a Polyclonal antibody targeting NOL12 in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 15456-1-AP targets NOL12 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, SH-SY5Y cells, HepG2 cells, Raji cells Positive IP detected in: HeLa cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Nucleolar protein 12 (NOL12), a multifunctional RNA-binding protein, has been found to be related to genomic stability, DNA damage repair, and apoptosis. High expression of NOL12 is associated with worse reduced overall survival (OS), high pathological grade, node metastasis, and advanced clinical stage in patients with HCC (PMID: 35693698). Knockdown of NOL12 impairs cellular proliferation by inducing a G1/S cell cycle arrest, but does so outside of a nucleolar stress response and in a p53-independent manner (PMID: 29069457). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7723 Product name: Recombinant human NOL12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-213 aa of BC002808 Sequence: MGRNKKKKRDGDDRRPRLVLSFDEEKRREYLTGFHKRKVERKKAAIEEIKQRLKEEQRKLREERHQEYLKMLAEREEALEEADELDRLVTAKTESVQYDHPNHTVTVTTISDLDLSGARLLGLTPPEGGAGDRSEEEASSTEKPTKALPRKSRDPLLSQRISSLTASLHAHSRKKVKRKHPRRAQDSKKPPRAPRTSKAQRRRLTGKARHSGE Predict reactive species Full Name: nucleolar protein 12 Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC002808 Gene Symbol: NOL12 Gene ID (NCBI): 79159 RRID: AB_2282718 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UGY1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924