Iright
BRAND / VENDOR: Proteintech

Proteintech, 15463-1-AP, SIN1/MAPKAP1 Polyclonal antibody

CATALOG NUMBER: 15463-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SIN1/MAPKAP1 (15463-1-AP) by Proteintech is a Polyclonal antibody targeting SIN1/MAPKAP1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 15463-1-AP targets SIN1/MAPKAP1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, HeLa cells Positive IP detected in: mouse kidney tissue Positive IHC detected in: mouse kidney tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Mitogen-activated protein kinase 2-associated protein 1 (MAPKAP1) is also named as MIP1 and SIN1. SIN1/MAPKAP1 is a major partner of mTORC2, acting as a scaffold and responsible for the substrate specificity of the mTOR catalytic subunit (PMID: 37877351). Besides as a component of MTORC2, MAPKAP1 also functions as MEKK2 and Ras-interacting protein and involves in regulating MEKK2 activation and RAS signaling (PMID: 31773361). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7753 Product name: Recombinant human MAPKAP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-324 aa of BC002326 Sequence: MAFLDNPTIILAHIRQSHVTSDDTGMCEMVLIDHDVDLEKIHPPSMPGDSGSEIQGSNGETQGYVYAQSVDITSSWDFGIRRRSNTAQRLERLRKERQNQIKCKNIQWKERNSKQSAQELKSLFEKKSLKEKPPISGKQSILSVRLEQCPLQLNNPFNEYSKFDGKGHVGTTATKKIDVYLPLHSSQDRLLPMTVVTMASARVQDLIGLICWQYTSEGREPKLNDNVSAYCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVEKYSSPGLTSKESLFVRINAAHGFSLIQVDNTKVTMKEILLKAVKRRKGSQKVSGSRAD Predict reactive species Full Name: mitogen-activated protein kinase associated protein 1 Calculated Molecular Weight: 59 kDa Observed Molecular Weight: 65 kDa GenBank Accession Number: BC002326 Gene Symbol: MAPKAP1 Gene ID (NCBI): 79109 RRID: AB_10598466 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BPZ7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924