Proteintech, 15474-1-AP, MAGEA11 Polyclonal antibody

Size: 20ul / 150ul The MAGEA11 (15474-1-AP) by Proteintech is a Polyclonal antibody targeting MAGEA11 in WB, IF/ICC, ELISA applications with reactivity to human samples 15474-1-AP targets MAGEA11 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A375 cells Positive IF/ICC detected in: A375 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7778 Product name: Recombinant human MAGEA11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 79-429 aa of BC004479 Sequence: RTQRITGGEQVLWGPITQIFPTVRPADLTRVIMPLEQRSQHCKPEEGLQAQEEDLGLVGAQALQAEEQEAAFFSSTLNVGTLEELPAAESPSPPQSPQEESFSPTAMDAIFGSLSDEGSGSQEKEGPSTSPDLIDPESFSQDILHDKIIDLVHLLLRKYRVKGLITKAEMLGSVIKNYEDYFPEIFREASVCMQLLFGIDVKEVDPTSHSYVLVTSLNLSYDGIQCNEQSMPKSGLLIIVLGVIFMEGNCIPEEVMWEVLSIMGVYAGREHFLFGEPKRLLTQNWVQEKYLVYRQVPGTDPACYEFLWGPRAHAETSKMKVLEYIANANGRDPTSYPSLYEDALREEGEGV Predict reactive species Full Name: melanoma antigen family A, 11 Calculated Molecular Weight: 48 kDa Observed Molecular Weight: 48 kDa, 44 kDa GenBank Accession Number: BC004479 Gene Symbol: MAGEA11 Gene ID (NCBI): 4110 RRID: AB_2137973 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P43364 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.