Proteintech, 15488-1-AP, UBE2E3 Polyclonal antibody

Size: 20ul / 150ul The UBE2E3 (15488-1-AP) by Proteintech is a Polyclonal antibody targeting UBE2E3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 15488-1-AP targets UBE2E3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, mouse kidney tissue, mouse liver tissue, Y79 cells Positive IHC detected in: human heart tissue, human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse, rat, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7838 Product name: Recombinant human UBE2E3 protein Source: e coli. -derived, PKG Tag: GST Domain: 1-207 aa of BC003554 Sequence: MSSDRQRSDDESPSTSSGSSDADQRDPAAPEPEEQEERKPSATQQKKNTKLSSKTTAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQWTKRYAT Predict reactive species Full Name: ubiquitin-conjugating enzyme E2E 3 (UBC4/5 homolog, yeast) Calculated Molecular Weight: 23 kDa Observed Molecular Weight: 23-27 kDa GenBank Accession Number: BC003554 Gene Symbol: UBE2E3 Gene ID (NCBI): 10477 RRID: AB_10896456 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q969T4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.