Iright
BRAND / VENDOR: Proteintech

Proteintech, 15492-1-AP, MARK2 Polyclonal antibody

CATALOG NUMBER: 15492-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MARK2 (15492-1-AP) by Proteintech is a Polyclonal antibody targeting MARK2 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 15492-1-AP targets MARK2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IP detected in: rat brain tissue Positive IHC detected in: human prostate cancer tissue, human brain tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information MARK2 is also named as EMK1(ELKL motif kinase 1), Par1b and belongs to the CAMK Ser/Thr protein kinase family. Par1b/MARK2 plays a critical role in neuronal polarity in the process of axon specification from multiple candidate neurites using primary cultures of mammalian hippocampal neurons(PMID:20194617). It has 16 isoforms produced by alternative promoter usage and alternative splicing with the molecular mass of 77-90kDa and can exsit as a dimer(PMID:16803889). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7884 Product name: Recombinant human MARK2 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-363 aa of BC008771 Sequence: LNERDTEQPTLGHLDSKPSSKSNMIRGRNSATSADEQPHIGNYRLLKTIGKGNFAKVKLARHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGFSNEFTFGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGYKSSELEGDTI Predict reactive species Full Name: MAP/microtubule affinity-regulating kinase 2 Calculated Molecular Weight: 88 kDa Observed Molecular Weight: 77-90 kDa GenBank Accession Number: BC008771 Gene Symbol: MARK2 Gene ID (NCBI): 2011 RRID: AB_2140752 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7KZI7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924