Proteintech, 15511-1-AP, SMU1 Polyclonal antibody

Size: 20ul / 150ul The SMU1 (15511-1-AP) by Proteintech is a Polyclonal antibody targeting SMU1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 15511-1-AP targets SMU1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, K-562 cells Positive IHC detected in: human kidney tissue, human brain tissue, human hepatocirrhosis tissue, human ovary tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information Sum1, belongs to the WD repeat SMU1 family. Human SMU1 is a component of the spliceosome fSAP57(PMID: 15254247). It is possible that the mutation in Smu1 affects spliceosome function, resulting in generation of improper splice variants, which could explain the phenotypes of tsTM18 cells. Some results suggest that Smu1 participates in at least two steps of splicing: splice-site choice and control of accuracy(PMID: 17105761). This antibody is a rabbit polyclonal antibody raised against a region of human REDD1 antigen. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7688 Product name: Recombinant human SMU1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 365-513 aa of BC002876 Sequence: ISASSDGTVKIWNMKTTECSNTFKSLGSTAGTDITVNSVILLPKNPEHFVVCNRSNTVVIMNMQGQIVRSFSSGKREGGDFVCCALSPRGEWIYCVGEDFVLYCFSTVTGKLERTLTVHEKDVIGIAHHPHQNLIATYSEDGLLKLWKP Predict reactive species Full Name: smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) Calculated Molecular Weight: 58 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC002876 Gene Symbol: SMU1 Gene ID (NCBI): 55234 RRID: AB_2270843 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q2TAY7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.