Iright
BRAND / VENDOR: Proteintech

Proteintech, 15514-1-AP, HAGHL Polyclonal antibody

CATALOG NUMBER: 15514-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HAGHL (15514-1-AP) by Proteintech is a Polyclonal antibody targeting HAGHL in WB, ELISA applications with reactivity to human samples 15514-1-AP targets HAGHL in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information HAGHL, or HAGHL gene, is a gene located on chromosome 16p13.3, and it encodes a protein that has been identified as a novel metabolic oncogene involved in the progression of human colorectal cancer (CRC). Recent studies have demonstrated that HAGHL plays a critical role in regulating CRC by influencing various metabolic pathways, which may contribute to tumor growth and development. (PMID: 36417085) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7729 Product name: Recombinant human HAGHL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-282 aa of BC004353 Sequence: MKVKVIPVLEDNYMYLVIEELTREAVAVDVAVPKRLLEIVGREGVSLTAVLTTHHHWDHARGNPELARLRPGLAVLGADERIFSLTRRLAHGEELRFGAIHVRCLLTPGHTAGHMSYFLWEDDCPDPPALFSGDALSVAGCGSCLEGSAQQMYQSLAELGTLPPETKVFCGHEHTLSNLEFAQKVEPCNDHVRAKLSWAKKRDEDDVPTVPSTLGEERLYNPFLRVAEEPVRKFTGKAVPADVLEALCKERARFEQAGEPRQPQARALLALQWGLLSAAPHD Predict reactive species Full Name: hydroxyacylglutathione hydrolase-like Calculated Molecular Weight: 32 kDa Observed Molecular Weight: 31 kDa GenBank Accession Number: BC004353 Gene Symbol: HAGHL Gene ID (NCBI): 84264 RRID: AB_3669210 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6PII5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924