Iright
BRAND / VENDOR: Proteintech

Proteintech, 15525-1-AP, SF3B5 Polyclonal antibody

CATALOG NUMBER: 15525-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SF3B5 (15525-1-AP) by Proteintech is a Polyclonal antibody targeting SF3B5 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 15525-1-AP targets SF3B5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SH-SY5Y cells, HeLa cells, mouse eye tissue Positive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Hela cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7205 Product name: Recombinant human SF3B5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-86 aa of BC000198 Sequence: MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPCGPPADKPEEN Predict reactive species Full Name: splicing factor 3b, subunit 5, 10kDa Calculated Molecular Weight: 10 kDa Observed Molecular Weight: 10-12 kDa GenBank Accession Number: BC000198 Gene Symbol: SF3B5 Gene ID (NCBI): 83443 RRID: AB_10596628 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BWJ5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924