Proteintech, 15527-1-AP, PRSS8 Polyclonal antibody

Size: 20ul / 150ul The PRSS8 (15527-1-AP) by Proteintech is a Polyclonal antibody targeting PRSS8 in IHC, ELISA applications with reactivity to human, mouse, rat samples 15527-1-AP targets PRSS8 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: mouse ovary tissue, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Protease serine S1 family member 8 (PRSS8), a membrane-anchored serine protease, has been reported to be involved in the development of several human cancers. PRSS8 protein level was highly expressed in well differentiated cancer cell and was lower or absent in poorly differentiated cancer cell. Significantly higher levels of prostasin were found in early stage OVC serum samples compared to benign ovarian and normal donor samples. Overexpression of PRSS8 mRNA and high levels of prostasin in multiple subtypes of early stage ovarian tumors may provide clinical biomarkers for early detection of OVC. (PMID: 27036110, PMID: 27050145) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7234 Product name: Recombinant human PRSS8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 26-325 aa of BC001462 Sequence: SGTGAEGAEAPCGVAPQARITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNCLYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASWIQSKVTELQPRVVPQTQESQPDSNLCGSHLAFSSAPAQGLLRPIL Predict reactive species Full Name: protease, serine, 8 Calculated Molecular Weight: 36 kDa Observed Molecular Weight: 39 kDa GenBank Accession Number: BC001462 Gene Symbol: PRSS8 Gene ID (NCBI): 5652 RRID: AB_2172168 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16651 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.