Proteintech, 15539-1-AP, Cytokeratin 7 Polyclonal antibody

Size: 20ul / 150ul The Cytokeratin 7 (15539-1-AP) by Proteintech is a Polyclonal antibody targeting Cytokeratin 7 in WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 15539-1-AP targets Cytokeratin 7 in WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, rat liver tissue, A431 cells, mouse liver tissue, mouse bladder tissue, HepG2 cells, mouse lung tissue, rat bladder tissue, rat lung tissue Positive IHC detected in: human pancreas tissue, human bowen disease, human breast cancer tissue, human kidney tissue, human lung tissue, human lung cancer tissue, human ovary tumor tissue, human stomach cancer tissue, mouse kidney tissue, mouse pancreas tissue, rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse pancreas tissue, rat liver tissue Positive IF-Fro detected in: mouse breast cancer Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:30000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension Background Information Cytokeratin 7 (CK7) is a type II keratin protein that is a principal constituent of the intermediate filament cytoskeleton. It is primarily expressed in simple epithelia lining the cavities of internal organs, glandular ducts, and blood vessels. Abnormal expression of CK7 has been linked to various pathological conditions, including cancer. Overexpression of CK7 promotes tumor progression and metastasis in different human cancers, and its suppression leads to rapid tumor regression, highlighting its potential as a therapeutic target CK7 is also involved in inhibiting interferon-dependent interphase, promoting DNA synthesis, initiating translation possibly through interaction with p150 (the largest subunit of eukaryotic translation initiation factor 3), and interacting with G protein-coupled estrogen receptor 1 (GPER1), which activates several signaling pathways. In the context of cancer diagnosis, CK7 is used as a marker to distinguish between different types of carcinomas. It is expressed in most adenocarcinomas, particularly those of the lung and colorectal origin, and is useful in differentiating primary ovarian carcinoma from metastatic colorectal carcinoma. CK7 expression has also been studied as a predictor of an unfavorable prognosis in colorectal carcinoma. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7895 Product name: Recombinant human CK7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC002700 Sequence: MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINRRTAAENEFVVLKKDVDAAYMSKVELEAKVDALNDEINFLRTLNETELTELQSQISDTSVVLSMDNSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDDLRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDAR Predict reactive species Full Name: keratin 7 Calculated Molecular Weight: 469 aa, 51 kDa Observed Molecular Weight: 51 kDa GenBank Accession Number: BC002700 Gene Symbol: Cytokeratin 7 Gene ID (NCBI): 3855 RRID: AB_2249769 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P08729 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.