Product Description
Size: 20ul / 150ul
The NDUFA1 (15561-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFA1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples
15561-1-AP targets NDUFA1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: mouse heart tissue, mouse kidney tissue, rat heart tissue, mouse liver tissue
Positive IHC detected in: mouse liver tissue, mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Background Information
The NDUFA1 gene encoding the MWFE polypeptide is located on the X chromosome. The NDUFA1 gene product (MWFE protein) is essential for activity of complex I in mammalian mitochondria, and it is predicted to be a membrane protein (PMID: 10200266).
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag7206 Product name: Recombinant human NDUFA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC000266 Sequence: MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID Predict reactive species
Full Name: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa
Calculated Molecular Weight: 7.5 kDa
Observed Molecular Weight: 8 kDa
GenBank Accession Number: BC000266
Gene Symbol: NDUFA1
Gene ID (NCBI): 4694
RRID: AB_2918040
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: O15239
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924