Proteintech, 15565-1-AP, SEH1L Polyclonal antibody

Size: 20ul / 150ul The SEH1L (15565-1-AP) by Proteintech is a Polyclonal antibody targeting SEH1L in WB, IF/ICC, ELISA applications with reactivity to human samples 15565-1-AP targets SEH1L in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7795 Product name: Recombinant human SEH1L protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-360 aa of BC012430 Sequence: MFVARSIAADHKDLIHDVSFDFHGRRMATCSSDQSVKVWDKSESGDWHCTASWKTHSGSVWRVTWAHPEFGQVLASCSFDRTAAVWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVKFAPKHMGLMLATCSADGIVRIYEAPDVMNLSQWSLQHEISCKLSCSCISWNPSSSRAHSPMIAVGSDDSSPNAMAKVQIFEYNENTRKYAKAETLMTVTDPVHDIAFAPNLGRSFHILAIATKDVRIFTLKPVRKELTSSGGPTKFEIHIVAQFDNHNSQVWRVSWNITGTVLASSGDDGCVRLWKANYMDNWKCTGILKGNGSPVNGSSQQGTSNPSLGSTIPSLQNSLNGSSAGRKHS Predict reactive species Full Name: SEH1-like (S. cerevisiae) Calculated Molecular Weight: 39.6 kDa Observed Molecular Weight: 36-39 kDa GenBank Accession Number: BC012430 Gene Symbol: SEH1L Gene ID (NCBI): 81929 RRID: AB_3085466 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96EE3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.