Proteintech, 15587-1-AP, HIG2 Polyclonal antibody

Size: 20ul / 150ul The HIG2 (15587-1-AP) by Proteintech is a Polyclonal antibody targeting HIG2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 15587-1-AP targets HIG2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information HIG2 (Hypoxia inducible gene 2), also known as hypoxia inducible lipid droplet associated (HILPDA), is a gene that plays a significant role in the context of hypoxia, particularly in cancer biology. HIG2 is can be induced by hypoxia and glucose deprivation. It is expressed under low-oxygen conditions, which are common in the tumor microenvironment, and has been identified as a target gene of hypoxia-inducible factor-1 (HIF-1). HIG2 is implicated in the development and progression of various types of cancer, including renal cell carcinoma(PMID: 15930302), cell lymphoma(PMID: 26757780), epithelial ovarian cancer(PMID: 20134266), and uterine cancer(PMID: 21614900). Its expression is often elevated in these cancers and is associated with poor prognosis. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7829 Product name: Recombinant human C7orf68 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-63 aa of BC001863 Sequence: MKHVLNLYLLGVVLTLLSIFVRVMESLEGLLESPSPGTSWTTRSQLANTEPTKGLPDHPSRSM Predict reactive species Full Name: chromosome 7 open reading frame 68 Calculated Molecular Weight: 7 kDa Observed Molecular Weight: 7-10 kDa GenBank Accession Number: BC001863 Gene Symbol: C7orf68 Gene ID (NCBI): 29923 RRID: AB_3669213 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y5L2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.