Proteintech, 15613-1-AP, Fibronectin Polyclonal antibody

Size: 20ul / 150ul The Fibronectin (15613-1-AP) by Proteintech is a Polyclonal antibody targeting Fibronectin in WB, IF/ICC, IF-P, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 15613-1-AP targets Fibronectin in WB, IF/ICC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human plasma, NIH/3T3 cells, MDA-MB-453s cells Positive IP detected in: NIH/3T3 cells Positive IF-P detected in: rat skin tissue, mouse brain tissue Positive IF/ICC detected in: NIH/3T3 cells, HUVEC cells Positive FC (Intra) detected in: NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:20000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Fibronectins play a role in cell adhesion, motility, wound healing, and the maintenance of cell shape. Fibronectins bind to cell surfaces via interactions with integrins and various molecules such as collagen, fibrin, heparin, DNA, and actin (PMID: 3326130). Cellular interaction with fibronectin (FN1) promotes cell cycle progression and proliferation by influencing cyclins.What is the molecular weight of FN1?The molecular weight of FN1 is 220 kDa.What is the tissue specificity of FN1?FN1 is a large glycoprotein that exists in both a soluble form in plasma (plasma FN1) and other body fluids and an insoluble form in the extracellular matrix (cellular FN1) (PMID: 21923916). Plasma FN1, or the dimeric form, is secreted by hepatocytes, whereas cellular FN1, the dimeric or cross-linked multimeric form, is produced by fibroblasts and epithelial cells and deposited as fibrils in the extracellular matrix.What are the post-translational modifications of FN1?FN1 is often sulfated and its C-terminal NC1 peptide, anastellin, is produced as a result of proteolytic processing and can inhibit tumor growth, angiogenesis, and metastasis by activating p38 MAPK and inhibiting lysophospholipid signaling (PMID: 11209058).What is FN1's role in embryogenesis?Fibronectin has a crucial role in the development of the left-right body axis during embryogenesis (PMID: 21466802).What is FN1's involvement in disease?Fibronectin glomerulopathy is a kidney disease that eventually leads to end-stage renal disease and is caused by mutations in the FN1 gene. Mutations in FN1 lead to the production of abnormal fibronectin protein that is deposited in the glomeruli of the kidney (PMID: 18268355). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, rabbit, bovine, hamster, sheep, medaka embryos Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8004 Product name: Recombinant human FN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2177-2386 aa of BC005858 Sequence: DQQRHKVREEVVTVGNSVNEGLNQPTDDSCFDPYTVSHYAVGDEWERMSESGFKLLCQCLGFGSGHFRCDSSRWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADREDSRE Predict reactive species Full Name: fibronectin 1 Calculated Molecular Weight: 2386 aa, 263 kDa Observed Molecular Weight: 250-275 kDa GenBank Accession Number: BC005858 Gene Symbol: Fibronectin Gene ID (NCBI): 2335 RRID: AB_2105691 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P02751 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.