Proteintech, 15622-1-AP, ICA1L Polyclonal antibody

Size: 20ul / 150ul The ICA1L (15622-1-AP) by Proteintech is a Polyclonal antibody targeting ICA1L in IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 15622-1-AP targets ICA1L in IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IF/ICC detected in: MCF-7 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8048 Product name: Recombinant human ICA1L protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-187 aa of BC000993 Sequence: MDSFGQPRPEDNQSVVRRMQKKYWKTKQVFIKATGKKEDEHLVASDAELDAKLEVFHSVQETCTELLKIIEKYQLRLNVISEEENELGLFLKFQAERDATQAGKMMDATGKALCSSAKQRLALCTPLSRLKQEVATFSQRAVSDTLMTINRMEQARTEYRGALLWMKDVSQELDPDTLKQMEKFRKV Predict reactive species Full Name: islet cell autoantigen 1,69kDa-like Calculated Molecular Weight: 54 kDa GenBank Accession Number: BC000993 Gene Symbol: ICA1L Gene ID (NCBI): 130026 RRID: AB_2121544 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NDH6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.