Iright
BRAND / VENDOR: Proteintech

Proteintech, 15648-1-AP, IL-17RC Polyclonal antibody

CATALOG NUMBER: 15648-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The IL-17RC (15648-1-AP) by Proteintech is a Polyclonal antibody targeting IL-17RC in WB, ELISA applications with reactivity to human, mouse samples 15648-1-AP targets IL-17RC in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A431 cells, HEK-293 cells, HepG2 cells, HeLa cells, L02 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information The IL-17 family has five receptors: IL-17RA (or IL-17R), IL-17RB (or IL-17Rh1), IL-17RC (or IL-17RL), IL-17RD and IL-17RE. IL-17RC is a 720-amino acid type I transmembrane protein with a 20-amino acid signal peptide, a 447-amino acid N-terminal extracellular domain, a 21-amino acid hydrophobic α-helical transmembrane domain, and a 232-amino acid intracellular domain(PMID: 18928529). IL17RC is widely expressed in nonleukocyte tissues and forms a heteromeric receptor for IL17 with IL17R(PMID: 16785495). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8190 Product name: Recombinant human IL-17RC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC006411 Sequence: MPVPWFLLSLALGRSPVVLSLERLVGPQDATHCSPGLSCRLWDSDILCLPGDIVPAPGPVLAPTHLQTELVLRCQKETDCDLCLRVAVHLAVHGHWEEPEDEEKFGGAADSGVEEPRNASLQAQVVLSFQAYPTARCVLLEVQVPAALVQFGQSVGSVVYDCFEAALGSEVRIWSYTQPRYEKELNHTQQLPALPWLNVSADGDNVHLVLNVSEEQHFGLSLYWNQVQGPPKPRWHKNLTGPQIITLNHTDLVPCLCIQVWPLEPDSVRTNICPFREDPRAHQNLWQAARLRLLTLQSWLLDAPCSLPAEAALCWRAPGGDPCQPLVPPLSWENVTVDKVLEFPLLKGHP Predict reactive species Full Name: interleukin 17 receptor C Calculated Molecular Weight: 791aa,86 kDa; 538aa,59 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC006411 Gene Symbol: IL-17RC Gene ID (NCBI): 84818 RRID: AB_2296016 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NAC3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924