Iright
BRAND / VENDOR: Proteintech

Proteintech, 15655-1-AP, XPNPEP3 Polyclonal antibody

CATALOG NUMBER: 15655-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The XPNPEP3 (15655-1-AP) by Proteintech is a Polyclonal antibody targeting XPNPEP3 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 15655-1-AP targets XPNPEP3 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, human testis tissue, human spleen tissue, PC-3 cells, 4T1 cells, mouse liver Positive IP detected in: PC-3 cells Positive IHC detected in: mouse liver tissue, human oesophagus tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information XPNPEP3 gene encodes X-prolyl aminopeptidase 3 which functions to remove the penultimate N-terminal Proline residue from nascent proteins and appears to play a role in ciliary function. CRC tissue microarray revealed increased XPNPEP3 expression in tumor compared to matched normal samples (PMID:29383790). Other study found that XPNPEP3 localizes to mitochondria in renal cells in vitro and to kidney tubules in a cell type-specific pattern, and mutations in the gene are associated with NPHP-like disorder (PMID:20179356). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8007 Product name: Recombinant human XPNPEP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 158-507 aa of BC004989 Sequence: PSRELWDGPRSGTDGAIALTGVDEAYTLEEFQHLLPKMKAETNMVWYDWMRPSHAQLHSDYMQPLTEAKAKSKNKVRGVQQLIQRLRLIKSPAEIERMQIAGKLTSQAFIETMFTSKAPVEEAFLYAKFEFECRARGADILAYPPVVAGGNRSNTLHYVKNNQLIKDGEMVLLDGGCESSCYVSDITRTWPVNGRFTAPQAELYEAVLEIQRDCLALCFPGTSLENIYSMMLTLIGQKLKDLGIMKNIKENNAFKAARKYCPHHVGHYLGMDVHDTPDMPRSLPLQPGMVITIEPGIYIPEDDKDAPEKFRGLGVRIEDDVVVTQDSPLILSADCPKEMNDIEQICSQAS Predict reactive species Full Name: X-prolyl aminopeptidase (aminopeptidase P) 3, putative Calculated Molecular Weight: 57 kDa Observed Molecular Weight: 57 kDa GenBank Accession Number: BC004989 Gene Symbol: XPNPEP3 Gene ID (NCBI): 63929 RRID: AB_2288500 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NQH7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924