Iright
BRAND / VENDOR: Proteintech

Proteintech, 15662-1-AP, RAB14 Polyclonal antibody

CATALOG NUMBER: 15662-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RAB14 (15662-1-AP) by Proteintech is a Polyclonal antibody targeting RAB14 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 15662-1-AP targets RAB14 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse kidney tissue, HepG2 cells, Raji cells, human brain tissue Positive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information RAB14, the final member of the Rab11 subfamily, participates in the regulation of cell secretion, ensuring the timely release of necessary substances outside the cell. RAB14 is ubiquitously expressed and localizes to the Golgi/TGN and at early endosomes (PMID: 16962593, 22595670). RAB14 contains 215 amino acids, with a molecular weight of approximately 24.6 kDa Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8092 Product name: Recombinant human RAB14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-215 aa of BC006081 Sequence: MATAPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCGC Predict reactive species Full Name: RAB14, member RAS oncogene family Calculated Molecular Weight: 215 aa, 24 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: BC006081 Gene Symbol: RAB14 Gene ID (NCBI): 51552 RRID: AB_2173630 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P61106 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924