Iright
BRAND / VENDOR: Proteintech

Proteintech, 15684-1-AP, REEP2 Polyclonal antibody

CATALOG NUMBER: 15684-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The REEP2 (15684-1-AP) by Proteintech is a Polyclonal antibody targeting REEP2 in WB, IHC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 15684-1-AP targets REEP2 in WB, IHC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, human heart tissue, mouse eye tissue, human skeletal muscle tissue, rat brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Positive FC (Intra) detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8186 Product name: Recombinant human REEP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 70-252 aa of BC006218 Sequence: IAFVIWLLSPYTKGSSVLYRKFVHPTLSNKEKEIDEYITQARDKSYETMMRVGKRGLNLAANAAVTAAAKGVLSEKLRSFSMQDLTLIRDEDALPLQRPDGRLRPSPGSLLDTIEDLGDDPALSLRSSTNPADSRTEASEDDMGDKAPKRAKPIKKAPKAEPLASKTLKTRPKKKTSGGGDSA Predict reactive species Full Name: receptor accessory protein 2 Calculated Molecular Weight: 252 aa, 28 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC006218 Gene Symbol: REEP2 Gene ID (NCBI): 51308 RRID: AB_2238326 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BRK0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924