Iright
BRAND / VENDOR: Proteintech

Proteintech, 15688-1-AP, ERCC6L Polyclonal antibody

CATALOG NUMBER: 15688-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ERCC6L (15688-1-AP) by Proteintech is a Polyclonal antibody targeting ERCC6L in WB, IHC, ELISA applications with reactivity to human, mouse samples 15688-1-AP targets ERCC6L in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, human heart tissue, Jurkat cells, mouse lung tissue, K-562 cells, U2OS cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ERCC6L, also named as Tumor antigen BJ-HCC-15 or PICH, is a 1250 amino acid protein, which contains one helicase ATP-binding domain, one helicase C-terminal domain and two TPR repeats. ERCC6L localizes to kinetochores, inner centromeres and belongs to the SNF2/RAD54 helicase family. ERCC6L as a DNA helicase that acts as an essential component of the spindle assembly checkpoint. The calculated molecular weight of ERCC6L is 140 kDa, but the phosphorylated modification of molecular weight of ERCC6L is about 180kDa. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8223 Product name: Recombinant human ERCC6L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 110-454 aa of BC008808 Sequence: NAESNVSIIEIADDLSASHSALQDAQASEAKLEEEPSASSPQYACDFNLFLEDSADNRQNFSSQSLEHVEKENSLCGSAPNSRAGFVHSKTCLSWEFSEKDDEPEEVVVKAKIRSKARRIVSDGEDEDDSFKDTSSINPFNTSLFQFSSVKQFDASTPKNDISPPGRFFSSQIPSSVNKSMNSRRSLASRRSLINMVLDHVEDMEERLDDSSEAKGPEDYPEEGVEESSGEASKYTEEDPSGETLSSENKSSWLMTSKPSALAQETSLGAPEPLSGEQLVGSPQDKAAEATNDYETLVKRGKELKECGKIQEALNCLVKALDIKSADPEVMLLTLSLYKQLNNN Predict reactive species Full Name: excision repair cross-complementing rodent repair deficiency, complementation group 6-like Calculated Molecular Weight: 419 aa, 46 kDa, 141 kDa Observed Molecular Weight: 180 kDa GenBank Accession Number: BC008808 Gene Symbol: ERCC6L Gene ID (NCBI): 54821 RRID: AB_2098171 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q2NKX8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924