Proteintech, 15690-1-AP, AP2B1 Polyclonal antibody

Size: 20ul / 150ul The AP2B1 (15690-1-AP) by Proteintech is a Polyclonal antibody targeting AP2B1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 15690-1-AP targets AP2B1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, SH-SY5Y cells, K-562 cells, C6 cells, NIH/3T3 cells Positive IP detected in: K-562 cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:1000-1:4000 Background Information AP2B1 is a component of the adaptor protein complex 2 (AP-2). AP complexes are cytosolic heterotetramers that mediate the sorting of membrane proteins in the secretory and endocytic pathways. AP complexes are involved in the formation of clathrin-coated vesicles (CCVs) by recruiting the scaffold protein, clathrin. AP complexes also play a pivotal role in the cargo selection by recognizing the sorting signals within the cytoplasmic tail of integral membrane proteins. AP-2 works on the plasma membrane to internalize cargo in clathrin-mediated endocytosis. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, pig, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8248 Product name: Recombinant human AP2B1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 598-951 aa of BC006201 Sequence: GSTDAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGGLDSLLGSDLGGGIGGSPAVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGIGMAPGGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN Predict reactive species Full Name: adaptor-related protein complex 2, beta 1 subunit Calculated Molecular Weight: 105 kDa Observed Molecular Weight: 100-105 kDa GenBank Accession Number: BC006201 Gene Symbol: AP2B1 Gene ID (NCBI): 163 RRID: AB_2056351 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P63010 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.