Iright
BRAND / VENDOR: Proteintech

Proteintech, 15719-1-AP, TUBGCP3 Polyclonal antibody

CATALOG NUMBER: 15719-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TUBGCP3 (15719-1-AP) by Proteintech is a Polyclonal antibody targeting TUBGCP3 in WB, ELISA applications with reactivity to human samples 15719-1-AP targets TUBGCP3 in WB, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information TUBGCP3, also named as γ‐tubulin complex protein 3, localized to the centrosome, is a member of γ-tubulin complex proteins which play key roles in microtubule nucleation and organization. It has been reported that TUBGCP3 rotation can bring γ-tubulin molecules into proximity. 15719-1-AP antibody detects the isoform proteins around 95-101 kDa and 50 kDa in SDS-PAGE. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8437 Product name: Recombinant human TUBGCP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC007763 Sequence: MATPDQKSPNVLLQNLCCRILGRSEADVAQQFQYAVRVIGSNFAPTVERDEFLVAEKIKKELIRQRREADAALFSELHRKLHSQGVLKNKWSILYLLLSLSEDPRRQPSKVSSYATLFAQALPRDAHSTPYYYARPQTLPLSYQDRSAQSAQSSGSVGSSGISSIGLCALSGPAPAPQSLLPGQSNQAPGVGDCLRQQLGSRLAWTLTANQPSSQATTSKGVPSAVSRNMTRSRREGDTGGTMEITEAALVRDILYVFQGIDGKNIKMNNTENCYKVEGKANLSRSLRDTAVRLSELGWLHNKIRRYTDQRSLDRSFGLVGQSFCAALHQELREYYRLLSVLHSQLQLED Predict reactive species Full Name: tubulin, gamma complex associated protein 3 Calculated Molecular Weight: 103.5 kDa Observed Molecular Weight: 95-101 kDa GenBank Accession Number: BC007763 Gene Symbol: TUBGCP3 Gene ID (NCBI): 10426 RRID: AB_2211272 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96CW5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924