Iright
BRAND / VENDOR: Proteintech

Proteintech, 15728-1-AP, NDUFS7 Polyclonal antibody

CATALOG NUMBER: 15728-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NDUFS7 (15728-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFS7 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 15728-1-AP targets NDUFS7 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, human brain tissue, Hela cells Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information NDUFS7(NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial) protein is one of the most conserved subunits of mitochondrial respiratory chain complex I and plays a central role in the interaction with the electron acceptor ubiquinone and in the proton-translocating mechanism(PMID:15269216).Defects in NDUFS7 are a cause of Leigh syndrome (LS) and mitochondrial complex I deficiency (MT-C1D). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8471 Product name: Recombinant human NDUFS7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-213 aa of BC005954 Sequence: MAVLSAPGLRGFRILGLRSSVGLAVQARGVHQSVATDGPSSTQPALPKARAVAPKPSSRGEYVVAKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIPGCPPTAEALLYGILQLQRKIKRERRLQIWYRR Predict reactive species Full Name: NADH dehydrogenase (ubiquinone) Fe-S protein 7, 20kDa (NADH-coenzyme Q reductase) Calculated Molecular Weight: 213 aa, 24 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC005954 Gene Symbol: NDUFS7 Gene ID (NCBI): 374291 RRID: AB_2149029 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75251 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924