Proteintech, 15733-1-AP, HLA-DRB4 Polyclonal antibody

Size: 20ul / 150ul The HLA-DRB4 (15733-1-AP) by Proteintech is a Polyclonal antibody targeting HLA-DRB4 in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human samples 15733-1-AP targets HLA-DRB4 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Daudi cells, Raji cells, Ramos cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse spleen tissue Positive IF/ICC detected in: Raji cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8492 Product name: Recombinant human HLA-DRB4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-266 aa of BC005312 Sequence: MVCLKLPGGSCMAALTVTLTVLSSPLALAGDTQPRFLEQAKCECHFLNGTERVWNLIRYIYNQEEYARYNSDLGEYQAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSMMSPLTVQWSARSESAQSKMLSGVGGFVLGLLFLGTGLFIYFRNQKGHSGLQPTGLLS Predict reactive species Full Name: major histocompatibility complex, class II, DR beta 4 Calculated Molecular Weight: 266 aa, 30 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC005312 Gene Symbol: HLA-DRB4 Gene ID (NCBI): 3126 RRID: AB_1939612 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P13762 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.