Iright
BRAND / VENDOR: Proteintech

Proteintech, 15775-1-AP, HTRA2 Polyclonal antibody

CATALOG NUMBER: 15775-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HTRA2 (15775-1-AP) by Proteintech is a Polyclonal antibody targeting HTRA2 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat, monkey samples 15775-1-AP targets HTRA2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat, monkey samples. Tested Applications Positive WB detected in: HeLa cells, HAP1 cells, human heart tissue, mouse skeletal muscle tissue, Raji cells, MCF-7 cells, Jurkat cells, HEK-293 cells, SH-SY5Y cells, COS-7 cells, Neuro-2a cells Positive IP detected in: Raji cells Positive IHC detected in: human kidney tissue, human colon tissue, human thyroid tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information HTRA2(High temperature requirement protein A2) is also named as OMI, PRSS25 and belongs to the peptidase S1B family. HTRA2 normally exists in the mitochondria, can cause MMP3 activation in the cytosol under a cell stress condition, which can ultimately lead to demise of dopaminergic neuronal cells(PMID: 22265821). It inhibits mitochondrial superoxide generation, stabilizes mitochondrial membrane potential, and prevents apoptosis at baseline and in response to extracellular inducers of mitochondrial stress(PMID: 18772386). This protein has 4 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat, monkey Cited Reactivity: human, mouse, rat, monkey, chicken, hamster Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8455 Product name: Recombinant human HTRA2 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 133-458 aa of BC000096 Sequence: AAVPSPPPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSSSGISGSQRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTE Predict reactive species Full Name: HtrA serine peptidase 2 Calculated Molecular Weight: 49 kDa Observed Molecular Weight: 36 kDa GenBank Accession Number: BC000096 Gene Symbol: HTRA2 Gene ID (NCBI): 27429 RRID: AB_2122835 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43464 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924