Proteintech, 15777-1-AP, HLA class I (HLA-C) Polyclonal antibody

Size: 20ul / 150ul The HLA class I (HLA-C) (15777-1-AP) by Proteintech is a Polyclonal antibody targeting HLA class I (HLA-C) in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 15777-1-AP targets HLA class I (HLA-C) in WB, IHC, IF/ICC, IP, ELISA, Cell treatment applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HL-60 cells, HeLa cells, HepG2 cells, Jurkat cells Positive IP detected in: HepG2 cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:400-1:1600 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information Human major histocompatibility complex (MHC) antigens, also referred to as human leukocyte antigens (HLA), are encoded by genes located on the short arm of chromosome 6 (6p21.3). There are two classes of HLA antigens: class I (HLA-A, B and C) and class II (HLA-D). This class I molecules are polymorphic membrane glycoproteins composed of a heavy (alpha) chain (44 kDa) which is encoded by a HLA class I gene (HLA-A, B or C), and β2-microglobulin light (beta) chain (12 kDa). They are involved in the presentation of foreign antigens to the immune system. This polyclonal antibody raised against human HLA-C can also react with HLA-A and HLA-B. (PMID: 667938; 3375250) Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8461 Product name: Recombinant human HLA class I (HLA-C) protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 27-305 aa of BC007814 Sequence: SMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEDGSHTLQRMSGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAARAAEQLRAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHMQHEGLQEPLTLSWEPSSQPTI Predict reactive species Full Name: major histocompatibility complex, class I, C Calculated Molecular Weight: 366 aa, 41 kDa Observed Molecular Weight: 44 kDa GenBank Accession Number: BC007814 Gene Symbol: HLA class I (HLA-C) Gene ID (NCBI): 3107 RRID: AB_1639892 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P10321 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.